Protein Info for MMJJ_RS08325 in Methanococcus maripaludis JJ

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00535: Glycos_transf_2
  • amino acids 8 to 164 (157 residues), 92.3 bits, E=1.7e-30

Best Hits

Swiss-Prot: 69% identical to Y1222_METJA: Uncharacterized protein MJ1222 (MJ1222) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 96% identity to mmp:MMP1170)

Predicted SEED Role

"Glycosyl transferase, family 2 (EC 2.4.1.83)" (EC 2.4.1.83)

MetaCyc Pathways

• protein O-mannosylation II (mammals, core M1 and core M2) (1/5 steps found)
• protein O-mannosylation III (mammals, core M3) (1/5 steps found)
• protein O-mannosylation I (yeast) (1/8 steps found)
• protein N-glycosylation (Haloferax volcanii) (1/11 steps found)
• protein N-glycosylation initial phase (eukaryotic) (2/19 steps found)

KEGG Metabolic Maps

• N-Glycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.83

Use Curated BLAST to search for 2.4.1.83

Protein Sequence (230 amino acids)

>MMJJ_RS08325 glycosyltransferase family 2 protein (Methanococcus maripaludis JJ)
MEKNDIFVVIPAYNEEKMIKNTLINLKSHGYENIIVVDDGSRDNTSKLAISEEIIVCKHI
INRGLGGALKTGLKCAVKYNPKVIVTFDADGQHDPEDIIKVSEPLLEDNFDVVVGSRLID
ENELKNMPLIKKIGNWGLNFITYLMGGQMVTDSQGGLRAFTHDAAEIVSKQLKSNRYEVS
SEFIVLFKKNNLKFKEVPIKTIYTEYSMARGTNVITGFKILFKLLIQKLI