Protein Info for MMJJ_RS08320 in Methanococcus maripaludis JJ
Annotation: CDP-diacylglycerol--serine O-phosphatidyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 59% identical to PSS_METJA: CDP-diacylglycerol--serine O-phosphatidyltransferase (pssA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 99% identity to mmp:MMP1171)Predicted SEED Role
"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)
MetaCyc Pathways
- phosphatidylserine and phosphatidylethanolamine biosynthesis I (1/2 steps found)
- cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (1/4 steps found)
- superpathway of phospholipid biosynthesis III (E. coli) (3/12 steps found)
- superpathway of cardiolipin biosynthesis (bacteria) (3/13 steps found)
- superpathway of phospholipid biosynthesis II (plants) (3/28 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.8.8
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (204 amino acids)
>MMJJ_RS08320 CDP-diacylglycerol--serine O-phosphatidyltransferase (Methanococcus maripaludis JJ) MFKIRNIITISDYVTVINIIFGMLAILLHDFRFVYLSIVFDALDGIVARKTNTVSEFGAE LDSICDVVSFGVAPAYLIYYYFDSTVSIIGSIIFLIGGALRLARFGILDVKHFIGLPIPA AALFLCILTQMSLKYGFGSGYVVSIIAVISGILMISDINYPKYPKKPLLVVFGISIILSM FGVIEPLAICAVLYVLYGIFKMKM