Protein Info for MMJJ_RS08285 in Methanococcus maripaludis JJ

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF01728: FtsJ" amino acids 34 to 120 (87 residues), 23.8 bits, see alignment E=1.9e-08 PF13489: Methyltransf_23" amino acids 37 to 145 (109 residues), 31.7 bits, see alignment E=6.2e-11 PF01209: Ubie_methyltran" amino acids 42 to 144 (103 residues), 42.8 bits, see alignment E=2.1e-14 PF05175: MTS" amino acids 42 to 116 (75 residues), 26.5 bits, see alignment E=2.3e-09 PF06325: PrmA" amino acids 44 to 147 (104 residues), 26.1 bits, see alignment E=2.9e-09 PF13847: Methyltransf_31" amino acids 45 to 161 (117 residues), 52.4 bits, see alignment E=2.7e-17 PF08241: Methyltransf_11" amino acids 47 to 145 (99 residues), 77.4 bits, see alignment E=5.4e-25 PF13649: Methyltransf_25" amino acids 47 to 141 (95 residues), 68.8 bits, see alignment E=2.8e-22 PF08242: Methyltransf_12" amino acids 47 to 142 (96 residues), 42.2 bits, see alignment E=5.5e-14

Best Hits

KEGG orthology group: None (inferred from 97% identity to mmp:MMP1179)

Predicted SEED Role

"Methlytransferase, UbiE/COQ5 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>MMJJ_RS08285 class I SAM-dependent methyltransferase (Methanococcus maripaludis JJ)
MSENKKKFDKKGAKNMDEISKTLFAPIYPIIAENIINRFGITAGTCIDIGSGPGALSIAL
AKQSDFSIRALDFSKHMNEIALKNIADANLNDRIQIVQGDVHNIPIEDNYADLIVSRGSV
FFWEDVATAFREIYRILKSGGKTYIGGGFGNKELRDSISAEMIRKNPDWKEFNRKNISQE
NVERFQNVLDEIGISSYEIILGDEGFWIIISKTDQEAI