Protein Info for MMJJ_RS08265 in Methanococcus maripaludis JJ

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 259 to 286 (28 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 323 to 343 (21 residues), see Phobius details PF01032: FecCD" amino acids 26 to 345 (320 residues), 317.9 bits, see alignment E=3.1e-99

Best Hits

Swiss-Prot: 75% identical to Y087_METJA: Putative ABC transporter permease protein MJ0087 (MJ0087) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 99% identity to mmp:MMP1182)

Predicted SEED Role

"Iron(III) dicitrate transport system permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>MMJJ_RS08265 iron ABC transporter permease (Methanococcus maripaludis JJ)
MENSVNTYKKYTLKKLIFGFVLIIALIIISIYALCTGDFQLSISQIINSLLGSGDASSNL
VIWNIRLPRIFAAILCGIGLSVSGAVMQCVLRNPLASPYTMGISHGAMFGACVAIITLGI
GGAESTGHIAINNPYSITIFAFLGSLLGVCAVLVLAKLKGLSPEAMVLAGVAISSLFTAA
TTLIQYFADDMQLAAMVYWSFGDLGRPLWPEVKIMALVAFVSLIYFIHKRWDYNALESGE
ETAKSLGVNTDKIRLSGMLVASLVTSVCVAFLGIIGFVGLICPHIIRITVGGDYRYLIPL
CSIFGAVLVLLADTIARTIISPIILPVGILTSFLGAPMFLYLLTKMYK