Protein Info for MMJJ_RS08245 in Methanococcus maripaludis JJ

Annotation: ATP-dependent protease LonB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 692 transmembrane" amino acids 115 to 133 (19 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details TIGR00764: putative ATP-dependent protease" amino acids 3 to 690 (688 residues), 691.7 bits, see alignment E=4.6e-212 PF01078: Mg_chelatase" amino acids 21 to 67 (47 residues), 21.6 bits, see alignment 4.6e-08 amino acids 229 to 320 (92 residues), 20.8 bits, see alignment E=8.1e-08 PF13654: AAA_32" amino acids 192 to 299 (108 residues), 22 bits, see alignment E=4.7e-08 PF00158: Sigma54_activat" amino acids 231 to 273 (43 residues), 28.9 bits, see alignment 3.1e-10 PF05362: Lon_C" amino acids 487 to 687 (201 residues), 75 bits, see alignment E=2.2e-24 PF13541: ChlI" amino acids 573 to 661 (89 residues), 30.1 bits, see alignment E=1.4e-10

Best Hits

KEGG orthology group: K04076, Lon-like ATP-dependent protease [EC: 3.4.21.-] (inferred from 100% identity to mmp:MMP1186)

Predicted SEED Role

"ATP-dependent protease LonB Type II"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (692 amino acids)

>MMJJ_RS08245 ATP-dependent protease LonB (Methanococcus maripaludis JJ)
MFSVQFKTTDELPKPSPNLINQVIGQDEAVKIVLSAVKNKRHALLLGDPGVGKSMMVKAF
GQLLEHSSDFKPYSLIARPNIKNSEKPIVDLIEGRMIEETAQIESPKLMRQPPSIFTLLL
GIIVSSLVLSYILNGLSDPSSKFAVIAAISVIGSLLVFLILFLNIFGATKASMPNSVSPA
DVKPLVLYECKKRPLVRASAYNTTKLLGDIKHCPLGGKPPIGTPPHKRVIIGAIHEAHKG
ILYVDEIKTMPVDVQDYILTALQDKQLAISGRNPNSSGASVETNPIPCDLTLIMSGNMDD
ASNLRAPLLDRIDYKVVLKNKMDNNQENRDKLLQFIVQELENNNLRPMSYEACCEIVRMA
QLLSGSKNKLTLRLRQLSNIIKMANDIATGKELSESIEEMSEKEVKPEVTVKAVKPTEKK
NTRKIRAVVGKLKPKKSEEVIKEVKPVSKAPVLEKDDRVIELDHINEIISTGIYSMSKQV
AIDYLKNFKRYKNIVSNDKPKIGVIHGLAVLGADGLGDVTKIITKIVKSKHPRTNLLNIS
GDLAKHSITLASALSKKLVSDGTLSIAKAKGEVAKEDLDLAEHEIYIQFSQSYSKIDGDS
ATAAACLSIISSLLNIPLKQDFCITGSLDLNGEILAIGGVNEKINAAKEYGFKRVIIPQS
NFEDVIDPEGIEVIPVTRLEEIIPLAFELNNL