Protein Info for MMJJ_RS08200 in Methanococcus maripaludis JJ

Annotation: surface protein, anchor region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 635 to 655 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 96% identity to mmp:MMP1194)

Predicted SEED Role

"Flagellar hook-length control protein FliK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (667 amino acids)

>MMJJ_RS08200 surface protein, anchor region (Methanococcus maripaludis JJ)
MKKIYTVLLVFALVSCLSIVSADSIPQFPHTFYGDVTINELPATGTLKVLVNGVESEQVP
VTDGEFGKGLFDAKLVVNGASGDQITFSFESEGYTLDSDYKIYLIDSEQYVSEIDFVSGG
YTEILLEFTGTGDVGDTGDTGDTGDTGDTGDTGDTGDTGDTGDTGDTGDTGNGEQLPLNP
GVFYGLVYLDESLASSTLNLYVDGVLQDSIGIENGVFGGEGALDDKLIATGYDGNSNVVT
FSLVSGGETYSSFTAELSDATYEDELPYIEGVHYVVLTFSETADTGNGEELPLNPGVFYG
MAYLDESLASSTLNLYVDGVLQDSIGIENGVFGGEGALDDKLIATGYDGNSNVVTFSLVS
GGETYSSFTAELSDATYEDELPYIEGVHYVVLTFSETADTGDTGDGGDTGNINSSEQLPL
NPDIFYGMVYLDEALASSTLNLYVDGALQNSIGIENGVFGGEGPLDNKLIATGYDGNSNV
VTFSLVSGGETYSSFTAELSDATYEDELPYIEGVHYVVLTFSETADTGDTGDTGDTSDSG
SSSGGGGGGSSRSSSSGSSSIISSSDSSETPVTTSVPKTSSSGTSTDSSSNTVESSENVG
PDTTQDSPDDTLDYGSDSNETGVVLQQESPLGGINMYLALAAILLILIALAAAWYQSKEK
PEVVPQQ