Protein Info for MMJJ_RS08185 in Methanococcus maripaludis JJ

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 107 to 136 (30 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 210 to 211 (2 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 75 to 244 (170 residues), 75.3 bits, see alignment E=2.6e-25

Best Hits

Swiss-Prot: 71% identical to Y413_METJA: Putative ABC transporter permease protein MJ0413 (MJ0413) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to mmp:MMP1197)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, permease component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>MMJJ_RS08185 ABC transporter permease (Methanococcus maripaludis JJ)
MKILKNLTLPIIGILAWEALAIYLNNPVILPKVESVISILLNPGVGILGTGNLIENTIVS
IKRVLIGFFIAGAFAIPLGLLMGYYSLINDLFDTTVELLRPIPPLAWVPLALAWFGIGES
SMHFIILIGAFFPILINTISGVKSVPVIMIEAAKTLGGSTKDILKSVVVPASSPDILTGL
RVGAGIAWMCVVAAEMLPGSDAGLGYLIMYAYSLSKMNIVVASMIIIGIIGIILDKGLRY
IEKKYFCWKKMMK