Protein Info for MMJJ_RS08155 in Methanococcus maripaludis JJ
Annotation: cobalt-precorrin-5B (C(1))-methyltransferase CbiD
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 92% identical to CBID_METMP: Cobalt-precorrin-5B C(1)-methyltransferase (cbiD) from Methanococcus maripaludis (strain S2 / LL)
KEGG orthology group: K02188, cobalamin biosynthesis protein CbiD (inferred from 92% identity to mmp:MMP1203)Predicted SEED Role
"Cobalt-precorrin-6 synthase, anaerobic" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis
MetaCyc Pathways
- cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (14/15 steps found)
- adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (365 amino acids)
>MMJJ_RS08155 cobalt-precorrin-5B (C(1))-methyltransferase CbiD (Methanococcus maripaludis JJ) MGKIDFRFEKTFGYTTGACAAAGAFSALYFLKNNEKLNFVEILNLKGDSLIIPIKNIEKL GNTAISTVEKFSGEDIDITNGMDIKIDVTLEKFDNNSPKPSNIKIIGGIGVGIVTKSGLQ VKPGEPAINPKPREMIENNLQSLLKNDECVTVKISVPNGDEIAKKTLNPKLGIIGGISIL GTTGIVRPMSNDAYKESLAPQIDVALANNFKNLIFVPGNIGTKHAKILLDAKEDQIIEVS NFWDYMLDKAEEKGVKDITVFGHAGKIVKLAGGIFDTHSRVADARNEIICAYTSLVSQDV ELFQKILYSNTTEDIVEILTEKGILTEVFDKVSKRVVERLSLRWEGINFSCIIIDMKGNV LGKSD