Protein Info for MMJJ_RS08155 in Methanococcus maripaludis JJ

Annotation: cobalt-precorrin-5B (C(1))-methyltransferase CbiD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01888: CbiD
  • amino acids 12 to 273 (262 residues), 310.3 bits, E=4.6e-97
• TIGR00312: cobalamin biosynthesis protein CbiD
  • amino acids 17 to 362 (346 residues), 445.1 bits, E=7e-138

Best Hits

Swiss-Prot: 92% identical to CBID_METMP: Cobalt-precorrin-5B C(1)-methyltransferase (cbiD) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02188, cobalamin biosynthesis protein CbiD (inferred from 92% identity to mmp:MMP1203)

Predicted SEED Role

"Cobalt-precorrin-6 synthase, anaerobic" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (14/15 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)

Protein Sequence (365 amino acids)

>MMJJ_RS08155 cobalt-precorrin-5B (C(1))-methyltransferase CbiD (Methanococcus maripaludis JJ)
MGKIDFRFEKTFGYTTGACAAAGAFSALYFLKNNEKLNFVEILNLKGDSLIIPIKNIEKL
GNTAISTVEKFSGEDIDITNGMDIKIDVTLEKFDNNSPKPSNIKIIGGIGVGIVTKSGLQ
VKPGEPAINPKPREMIENNLQSLLKNDECVTVKISVPNGDEIAKKTLNPKLGIIGGISIL
GTTGIVRPMSNDAYKESLAPQIDVALANNFKNLIFVPGNIGTKHAKILLDAKEDQIIEVS
NFWDYMLDKAEEKGVKDITVFGHAGKIVKLAGGIFDTHSRVADARNEIICAYTSLVSQDV
ELFQKILYSNTTEDIVEILTEKGILTEVFDKVSKRVVERLSLRWEGINFSCIIIDMKGNV
LGKSD