Protein Info for MMJJ_RS08085 in Methanococcus maripaludis JJ

Annotation: DUF2100 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF09873: SepCysE" amino acids 4 to 219 (216 residues), 296.3 bits, see alignment E=7.8e-93

Best Hits

Swiss-Prot: 51% identical to Y1481_METJA: Uncharacterized protein MJ1481 (MJ1481) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 98% identity to mmp:MMP1217)

Predicted SEED Role

"Uncharacterized protein MTH_1195"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>MMJJ_RS08085 DUF2100 domain-containing protein (Methanococcus maripaludis JJ)
MSETQYSKELIKKAVETISKAKTVSATQNFEKNENKKTFSDAKSGKIDTIEFKKAVHSLF
EADEYLYKYAPNHDLDEEKAREFSKLLFDAQKHINNVLGGFGFDIETVALDGQALYIVSN
KKVLKSLKDINPYLNIISTEGVLEIEDMKVVNPKIPEKALPGIEKKCKITKEQISKVISN
ISPSKVVVLVKDGDVADELIYKRAKELYNAEKLNADEIL