Protein Info for MMJJ_RS08020 in Methanococcus maripaludis JJ

Annotation: nucleotidyltransferase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 PF01909: NTP_transf_2" amino acids 141 to 219 (79 residues), 23.7 bits, see alignment E=2.6e-09

Best Hits

Swiss-Prot: 61% identical to Y1086_METJA: Uncharacterized protein MJ1086 (MJ1086) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K09717, hypothetical protein (inferred from 99% identity to mmp:MMP1230)

Predicted SEED Role

"Uncharacterized protein MJ1086"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>MMJJ_RS08020 nucleotidyltransferase domain-containing protein (Methanococcus maripaludis JJ)
MDTRIRDFVKTNEGYFAVNTYYHPENSVISFLRYINIDKIGNHLLKDYDLDENDIRILNG
ERFIKVADSSKAYAILKEYYPEYLFYDEINDVLLHAIPKNNIKEILSPQKRLEEVLNEQN
TEAEIKCAKLADTLHDYGLEYKNMGVSGSTVLKLNNENSDIDFVIYGMEKHKIAREILSV
TFKDGVLEPLSEDFWKKAYVKRIKDGTLTYDEFVWHEKRKLNRGVVDGVMFDLLATREWD
EITENYGDKKYKNLGFIQIKAKVKDDTFVFDNPAVYKVENVEILNNENNAEVLASEIEEV
VSFTHTYAGSTYNGEEIIVRGKLEEVYGKETYKRVVVGTTREAFNEYVKLAK