Protein Info for MMJJ_RS08005 in Methanococcus maripaludis JJ

Annotation: formate dehydrogenase accessory sulfurtransferase FdhD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF02634: FdhD-NarQ" amino acids 28 to 89 (62 residues), 30.3 bits, see alignment E=1.8e-11 amino acids 85 to 229 (145 residues), 150.5 bits, see alignment E=3.3e-48 TIGR00129: formate dehydrogenase family accessory protein FdhD" amino acids 88 to 229 (142 residues), 143.3 bits, see alignment E=4.1e-46

Best Hits

Swiss-Prot: 41% identical to FDHD_METJA: Protein FdhD (fdhD) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02379, FdhD protein (inferred from 95% identity to mmp:MMP1233)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>MMJJ_RS08005 formate dehydrogenase accessory sulfurtransferase FdhD (Methanococcus maripaludis JJ)
MSKMVTKVKTYSWSAEKGLLEKEDTIVTEDFYELYLDGKLIETMVVSPENIEELGIGYTI
SEGYIAPESFSEIKIDDKKIYVNSKELEKVDTKKGNVNLKLSTIKKIMETMPTLSDTWKI
TGGVHWAALFDFSGNKIVYFEDIGRHNAVDKVVGYAVLNNIDLNNCVLASSGRQPTAMVK
KVVNSKIPVIITKSPSTDKGVILAKENDILLIGFARIDRFTVYHGVEKIDFKS