Protein Info for MMJJ_RS07960 in Methanococcus maripaludis JJ

Annotation: quinolinate synthase NadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR00550: quinolinate synthetase complex, A subunit" amino acids 3 to 305 (303 residues), 385.1 bits, see alignment E=1.2e-119 PF02445: NadA" amino acids 5 to 303 (299 residues), 360.7 bits, see alignment E=2.9e-112

Best Hits

Swiss-Prot: 70% identical to NADA_METJA: Quinolinate synthase A (nadA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 96% identity to mmp:MMP1242)

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>MMJJ_RS07960 quinolinate synthase NadA (Methanococcus maripaludis JJ)
MDIIERINKLKNEKNAVILAHNYQPEEIQKIADIIGDSLELCIAARDTDADVIVFCGVDF
MAETAKVLNSGKKVLIPEIIETDCPMAHQLPPEVILDAKKEYPDAKVVIYVNTLASAKAL
ADATCTSANADRVVNSFEENEVLFGPDNNLGYFVSKRSNKKIIPMPEGGHCYVHKMFTID
DAKAVKEKYPNAELLIHPESDPKLQESADYVMSTGGMVKHVLNSECSEFIIGTECDMISR
LKIELEKVGKSKKLIPLRTDAICKSMKNITLEKIEQCLLEEKHEITLDEKIIENARKAIE
RMLSI