Protein Info for MMJJ_RS07935 in Methanococcus maripaludis JJ

Annotation: protein fwdD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01568: Molydop_binding
  • amino acids 3 to 102 (100 residues), 78.7 bits, E=1.8e-26

Best Hits

Swiss-Prot: 67% identical to FWDD_METJA: Protein FwdD (fwdD) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00203, formylmethanofuran dehydrogenase subunit D [EC: 1.2.99.5] (inferred from 97% identity to mmx:MmarC6_1426)

MetaCyc: 48% identical to tungsten formylmethanofuran dehydrogenase, subunit D (Archaeoglobus fulgidus DSM 4304)
FORMYLMETHANOFURAN-DEHYDROGENASE-RXN [EC: 1.2.7.12]

Predicted SEED Role

"Formylmethanofuran dehydrogenase (tungsten) subunit D (EC 1.2.99.5)" in subsystem Methanogenesis (EC 1.2.99.5)

MetaCyc Pathways

• gluconeogenesis II (Methanobacterium thermoautotrophicum) (16/18 steps found)
• methanogenesis from H₂ and CO₂ (6/6 steps found)
• methyl-coenzyme M oxidation to CO₂ II (6/6 steps found)
• methyl-coenzyme M oxidation to CO₂ I (5/6 steps found)
• reductive acetyl coenzyme A pathway II (autotrophic methanogens) (5/6 steps found)
• methoxylated aromatic compound degradation II (6/9 steps found)
• superpathway of methanogenesis (11/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (34/56 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.5

Use Curated BLAST to search for 1.2.7.12 or 1.2.99.5

Protein Sequence (128 amino acids)

>MMJJ_RS07935 protein fwdD (Methanococcus maripaludis JJ)
MKFMLNTGRTIWQGEAIEAGKNLEMYRKAAAVCYMNPEDMDALGVKDGDAIKVISEYGDV
AVNAITTDQPAPLGMIFIPMGPWANRVVLPDTESTAMPSFKGPLEVEVEKTDEEVLLMSD
LMRKAYIE