Protein Info for MMJJ_RS07920 in Methanococcus maripaludis JJ
Annotation: 6-carboxytetrahydropterin synthase QueD
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 59% identical to QUED_METJA: Putative 6-carboxy-5,6,7,8-tetrahydropterin synthase (queD) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K01737, 6-pyruvoyl tetrahydrobiopterin synthase [EC: 4.2.3.12] (inferred from 100% identity to mmp:MMP1250)Predicted SEED Role
"Queuosine biosynthesis QueD, PTPS-I" in subsystem Queuosine-Archaeosine Biosynthesis
MetaCyc Pathways
- erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
- threo-tetrahydrobiopterin biosynthesis (2/4 steps found)
- drosopterin and aurodrosopterin biosynthesis (4/7 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.2.3.12
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (167 amino acids)
>MMJJ_RS07920 6-carboxytetrahydropterin synthase QueD (Methanococcus maripaludis JJ) MILELNGIYAGLRFSAAHIVFGHDSCGVIHGHSYYVDVKLSGEPSGEFGFVCDFKILKQI VKELCSELDHKLLVPRDHENMEYSMEGDSIYLEYVEKSGNVKKYMFPVEDINLLPLKSTT AEDLSIYFTNYIEDKLQKMDLEKSIEWIETTVNEGIGQGARYTLHLK