Protein Info for MMJJ_RS07775 in Methanococcus maripaludis JJ

Annotation: fluoride efflux transporter CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00494: protein CrcB
  • amino acids 5 to 116 (112 residues), 115.4 bits, E=9.3e-38
• PF02537: CRCB
  • amino acids 5 to 114 (110 residues), 104.2 bits, E=2.3e-34

Best Hits

Swiss-Prot: 99% identical to CRCB_METMP: Putative fluoride ion transporter CrcB (crcB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K06199, CrcB protein (inferred from 99% identity to mmp:MMP1279)

Predicted SEED Role

"CrcB protein"

Protein Sequence (122 amino acids)

>MMJJ_RS07775 fluoride efflux transporter CrcB (Methanococcus maripaludis JJ)
MREILLIGLGGFFGAILRYLVSGIIPVKFGIPTGTLMVNLLGSFIIGFLIYSSLFGSLST
EYRLFIITGFCGALTTFSTFSYESFTMLEHNYYLKTGLNILLNVFGCLGMVYLGRLASMF
FW