Protein Info for MMJJ_RS07765 in Methanococcus maripaludis JJ

Annotation: DMT family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details PF04342: DMT_6" amino acids 6 to 109 (104 residues), 160.2 bits, see alignment E=7.8e-52

Best Hits

KEGG orthology group: K09922, hypothetical protein (inferred from 98% identity to mmp:MMP1280)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (112 amino acids)

>MMJJ_RS07765 DMT family protein (Methanococcus maripaludis JJ)
MKQYLPVLLLVLSNIFMTFAWYGHLKYKMSPLWIVILVSWGIAFFEYCLQVPANRIGSNY
FTPAQLKVIQEIITLVIFSIFSVLYLKEEFRWNYAVGFFFIILAAVFIFKKW