Protein Info for MMJJ_RS07760 in Methanococcus maripaludis JJ

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF13673: Acetyltransf_10" amino acids 43 to 139 (97 residues), 34.8 bits, see alignment E=3e-12 PF00583: Acetyltransf_1" amino acids 49 to 139 (91 residues), 58.6 bits, see alignment E=1.5e-19 PF13508: Acetyltransf_7" amino acids 56 to 139 (84 residues), 44.4 bits, see alignment E=3.7e-15 PF08445: FR47" amino acids 82 to 140 (59 residues), 24 bits, see alignment E=6.4e-09

Best Hits

Swiss-Prot: 32% identical to SAT1_MOUSE: Diamine acetyltransferase 1 (Sat1) from Mus musculus

KEGG orthology group: None (inferred from 90% identity to mmp:MMP1281)

MetaCyc: 31% identical to spermidine/spermine N1-acetyltransferase subunit (Homo sapiens)
Diamine N-acetyltransferase. [EC: 2.3.1.57]; 2.3.1.57 [EC: 2.3.1.57]

Predicted SEED Role

"Diamine acetyltransferase (EC 2.3.1.57)" (EC 2.3.1.57)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>MMJJ_RS07760 GNAT family N-acetyltransferase (Methanococcus maripaludis JJ)
MNTNLKINIRPTTVSDVPLIFKFIKELAKYENLEDHVTATEEIIKESLFGKKQYAETLIV
EADSKPAGFVLFFHNFSTFLGKPGIYIEDLYIKEEFRGMGIGRNIFEYLSNLATERNCGR
IDWVVLDWNPARKFYEKMGAIPVDNWLIYRLTGDKLDELSENYQKSKN