Protein Info for MMJJ_RS07700 in Methanococcus maripaludis JJ

Annotation: glycoside hydrolase family 57 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 PF03065: Glyco_hydro_57" amino acids 5 to 288 (284 residues), 291.4 bits, see alignment E=7.9e-91 PF01522: Polysacc_deac_1" amino acids 56 to 163 (108 residues), 26.6 bits, see alignment E=4.8e-10

Best Hits

Swiss-Prot: 59% identical to AMYA_METJA: Putative alpha-amylase (MJ1611) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07405, alpha-amylase [EC: 3.2.1.1] (inferred from 100% identity to mmp:MMP1291)

Predicted SEED Role

"Alpha-amylase (EC 3.2.1.1)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Biosynthesis (EC 3.2.1.1)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>MMJJ_RS07700 glycoside hydrolase family 57 protein (Methanococcus maripaludis JJ)
MLLSLNFEVHQPNRLRKSVNLNSGDLWNRYVDVELNKEIFNKVADKCYIPSNMIMLELID
NYDIELSYSITGVFLEQALEFNEEVVELFRDLAKTGNVEFLGETYHHSLSSLFEDHEEFK
EDILDHKKLIKELFGYKTTTFRNTELIFNNKIAETIKEMGFRGIFTEGANRILDWRSPNY
VYSALSGLNVLFRNYNLSDDIGFRFSSRDWKEYPLMADKYASWLSNTPGDCINLYMDYET
FGEHQWADTGIFEFLRYLPKELENYNHIEYSTPSEILELCTPKDTVDVFEFSTLSWADSE
RDLSAWLGNRMQQLSFQRLKEIRKYLGNYLKRYDEKERKELIEYKIYKNMQTSDNFYYMC
TKGFNDMDVHSYFSHFSTPYDAYSAYLDAYYDFKNHLVLKLISTYFK