Protein Info for MMJJ_RS07690 in Methanococcus maripaludis JJ

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08323: Glyco_transf_5
  • amino acids 2 to 165 (164 residues), 76.6 bits, E=7.5e-25
• PF13439: Glyco_transf_4
  • amino acids 15 to 183 (169 residues), 104.2 bits, E=2.5e-33
• PF20706: GT4-conflict
  • amino acids 16 to 329 (314 residues), 48.6 bits, E=1.9e-16
• PF13579: Glyco_trans_4_4
  • amino acids 16 to 180 (165 residues), 57.2 bits, E=8.1e-19
• PF00534: Glycos_transf_1
  • amino acids 197 to 363 (167 residues), 159 bits, E=2.6e-50
• PF13692: Glyco_trans_1_4
  • amino acids 209 to 350 (142 residues), 117.3 bits, E=2e-37

Best Hits

Swiss-Prot: 68% identical to Y1607_METJA: Uncharacterized glycosyltransferase MJ1607 (MJ1607) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 98% identity to mmp:MMP1293)

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Protein Sequence (391 amino acids)

>MMJJ_RS07690 glycosyltransferase family 4 protein (Methanococcus maripaludis JJ)
MKVSIVTWEYHPVMVGGLAVHCKGLSEALVRAGNEVDVITVGYDLPEYEEINGVNVYRVK
PISHNNFLTWAMFMASSFEKKIGSLGVENYDVIHCHDWMTSFVGSNIKHTTKKPYVQSIH
STERGRCGGINSEDSRAINDAEWWGSYEANQLIAVSHSIKDEMCFGFNTPWEKVNVIYNG
VNPWEFDINGDDNEKYNFRRNLGVNDNENMILYVGRLVYQKGVEHLIRGFQKFLIGHPNS
KLIIAGEGHMQGHLEHLAWVLGCGDRVIFLGFKNGTFLKKLYKYADACVIPSVYEPFGIV
ALESMAAGTPVVASDVGGLSEIINHEYNGVKVYPRDADSIAWGLDRVISDWGFREWVVKN
AKHDAYTKYSWDAIANQTIQVYKRAIEMMKQ