Protein Info for MMJJ_RS07660 in Methanococcus maripaludis JJ

Annotation: carbonic anhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00484: Pro_CA
  • amino acids 12 to 145 (134 residues), 60.6 bits, E=1.1e-20

Best Hits

KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 100% identity to mmp:MMP1299)

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

• gluconeogenesis II (Methanobacterium thermoautotrophicum) (16/18 steps found)
• cyanate degradation (2/3 steps found)
• CO₂ fixation into oxaloacetate (anaplerotic) (1/2 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (4/11 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (1/7 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (34/56 steps found)
• 3-hydroxypropanoate cycle (3/13 steps found)
• glyoxylate assimilation (3/13 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (3/14 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (4/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (3/18 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.1

Protein Sequence (150 amino acids)

>MMJJ_RS07660 carbonic anhydrase (Methanococcus maripaludis JJ)
MGENAKPKKKLAIVTCMDTRLVNFLSEKLGIAQGDAKVIKNAGNIITEDVIRSLVVAVYL
LGVEDIMIIGHTDCGMAAADFETVKKKMVERGANPNFTPDFEAWLGRMYCEETNVKEGVD
LLRNHPAMPKDITIDGYVMDIETGDLVKIA