Protein Info for MMJJ_RS07615 in Methanococcus maripaludis JJ
Annotation: fructose-6-phosphate aldolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to TAL_METMP: Probable transaldolase (tal) from Methanococcus maripaludis (strain S2 / LL)
KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 98% identity to mmq:MmarC5_0285)Predicted SEED Role
"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)
MetaCyc Pathways
- formaldehyde assimilation II (assimilatory RuMP Cycle) (8/9 steps found)
- pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
- Rubisco shunt (8/10 steps found)
- pentose phosphate pathway (5/8 steps found)
- Bifidobacterium shunt (10/15 steps found)
- superpathway of glucose and xylose degradation (10/17 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Pentose phosphate pathway
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.2.1.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (215 amino acids)
>MMJJ_RS07615 fructose-6-phosphate aldolase (Methanococcus maripaludis JJ) MKFFLDTANVEKIKEFNALGLVDGVTTNPSLIKKEGRDFYEVIKEICSIVDGPVSAEVIA LDAEGMVKEARELVKLAENVVVKIPMTKEGMKAVNILSKEGIKTNVTLIFSANQALLAAK AGASYVSPFVGRLDDVGQDGMFLISEVMQVFGAYGIETEVIVASVRHPIHVLESAKMGAD IATIPFDVIDKLFNHPLTDNGIAKFLADWEAHMNR