Protein Info for MMJJ_RS07500 in Methanococcus maripaludis JJ

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

Swiss-Prot: 54% identical to Y198_METJA: Uncharacterized protein MJ0198 (MJ0198) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1328)

Predicted SEED Role

"Enolase"

Protein Sequence (311 amino acids)

>MMJJ_RS07500 hypothetical protein (Methanococcus maripaludis JJ)
MENSTSIKRITAKKVFKDSKIQVRIATLTDKGIGYDTINAENPDYIISDVENVIAPELVG
YPAYDQDIIDSIICDTSVDSPKATMGTSLSVARAAANSIEIPLFKHIGGVLSTNLPIVGC
SLVSDGLNQLLTIPMAESIGEMVYIYNKLLSELSEEYAFKNNYGEYISKNLFNDIGKFKG
IVANISEEEDIEILVGAKISEFSPEIEELDYLESSEIIEFDGILCTENIDEEADFSKVDP
YLMGTLTEMNYYINYTIEKGLTPTISGNNTSFPHIAIGFKVPFLRANINSKVLNEIWNIE
RILNSPNITRF