Protein Info for MMJJ_RS07495 in Methanococcus maripaludis JJ

Annotation: 4Fe-4S binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 62 PF12837: Fer4_6" amino acids 3 to 27 (25 residues), 24.5 bits, see alignment E=7e-09 PF13237: Fer4_10" amino acids 3 to 53 (51 residues), 32.4 bits, see alignment E=2.6e-11 PF12800: Fer4_4" amino acids 8 to 24 (17 residues), 12 bits, see alignment E=8.6e-05 amino acids 40 to 55 (16 residues), 20.3 bits, see alignment E=1.9e-07 PF13187: Fer4_9" amino acids 10 to 57 (48 residues), 33 bits, see alignment E=1.8e-11 PF12838: Fer4_7" amino acids 14 to 56 (43 residues), 34 bits, see alignment E=1.1e-11 PF00037: Fer4" amino acids 39 to 58 (20 residues), 32.4 bits, see alignment E=2e-11

Best Hits

Swiss-Prot: 90% identical to FER_METTL: Ferredoxin from Methanothermococcus thermolithotrophicus

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1329)

Predicted SEED Role

"Ferredoxin" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (62 amino acids)

>MMJJ_RS07495 4Fe-4S binding protein (Methanococcus maripaludis JJ)
MSVVIDYDKCKGPECAECVNTCPVEVFEIQDDKVVVAKESDCTLCMVCVDVCPTDAITVK
ED