Protein Info for MMJJ_RS07410 in Methanococcus maripaludis JJ

Annotation: methanogenesis marker protein Mmp4/MtxX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 TIGR03270: putative methanogen marker protein 4" amino acids 27 to 240 (214 residues), 279.9 bits, see alignment E=4.9e-88

Best Hits

Swiss-Prot: 57% identical to Y1371_METJA: Uncharacterized methyltransferase MJ1371 (MJ1371) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 90% identity to mmq:MmarC5_0232)

Predicted SEED Role

"N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit X" in subsystem Methanogenesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>MMJJ_RS07410 methanogenesis marker protein Mmp4/MtxX (Methanococcus maripaludis JJ)
MYAIGIGKNRDEVLIAVENLKKEGINVELVENPEVLIDGLINNRYEGAVRGSLSSSELIP
ILRKNIGKFYRASILKNPFTNKIFILAPVGIDEISESPKIRFSEKLDIIKYSSEFLKSME
MIPKVGILSTGRLSDIGRSKKIDDSIIEAENLLKHVKSLDIFENLEIEHKGILIEEYLKE
GCNIILSDDGISGNLLFRAFALVCDMEGFGAIILNSENIKYIDTSRSGSWKRYYNAVKFL
KEGF