Protein Info for MMJJ_RS07395 in Methanococcus maripaludis JJ

Annotation: NAD+ synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 TIGR00552: NAD+ synthetase" amino acids 9 to 252 (244 residues), 266.8 bits, see alignment E=7.5e-84 PF02540: NAD_synthase" amino acids 13 to 251 (239 residues), 291.8 bits, see alignment E=4.8e-91 PF03054: tRNA_Me_trans" amino acids 31 to 91 (61 residues), 21.2 bits, see alignment E=3e-08 PF00733: Asn_synthase" amino acids 31 to 92 (62 residues), 22.4 bits, see alignment E=1.4e-08

Best Hits

Swiss-Prot: 67% identical to NADE_META3: NH(3)-dependent NAD(+) synthetase (nadE) from Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 97% identity to mmp:MMP1349)

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>MMJJ_RS07395 NAD+ synthase (Methanococcus maripaludis JJ)
MMRTNEQLEELANNICNFIKEQVENADAKGVVVGLSGGIDSALVAYLSVRALGKENVFGV
IMPEKNSNPDDEKYGKLVAESLGIEYEVFDITPVLVAFGAGGYVEGKEFDKRVDSNLKPR
IRMTEVYYHANKKNYLVAGTSNKSEIYMGYGTKYGDLGSDFLTIGNLFKTEVRQLAGYVG
VPKDIIDKAPSAGLWEGQTDEDELGISYETLDKLLNLMEKGKEIGDICEFLSIPPEKVGE
LMLRISTNKHKSLPLPMP