Protein Info for MMJJ_RS07390 in Methanococcus maripaludis JJ

Annotation: TIGR04014 family B12-binding domain/radical SAM domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 TIGR04014: B12-binding domain/radical SAM domain protein, MJ_0865 family" amino acids 2 to 432 (431 residues), 604.2 bits, see alignment E=6.8e-186 PF02310: B12-binding" amino acids 7 to 111 (105 residues), 33.8 bits, see alignment E=2.7e-12 PF04055: Radical_SAM" amino acids 162 to 330 (169 residues), 90.6 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 65% identical to Y865_METJA: Putative methylthiotransferase MJ0865 (MJ0865) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 95% identity to mmp:MMP1350)

Predicted SEED Role

"UPF0004 protein MJ0865"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>MMJJ_RS07390 TIGR04014 family B12-binding domain/radical SAM domain-containing protein (Methanococcus maripaludis JJ)
MKITIYSKDIYTYGAMLIGGILKETHKHSIKLTKDITNKKLFLKSDIVIFSLYSTLNIID
PMIKETIDYLKSKNIKIYVAGPVSAYPEIILNELNVDGVILGEGELTTPEIINGSTEGLA
YFENGEMIVNKPKSKPDLDFSKIYVPKDIAAQNVRGANVYIETHRGCLGHCTFCQVPEFF
GRDIRSKPIELIIEEVKELKKSGVNRIAISGGTGSLYNFKNTVNKNKFIEMIESVSDIIG
KQNLSVPDMRVDYVDEEVLNAIKNYSIGWVFYGIESGSDRLLNSMKKGTNSKKNLKAIKL
AKDCGVKVAGSFIVGHPQEKEVDFLLTKDFIVDAELEDVFVSAAEPIPKTELCNEVLNTK
MDENPTFISHNGPYRRYGLKENEARAYDLMLHSEMWKSNPRVITNNLSKVYLDEAKMQGS
DIRKATELIFKYRDFLI