Protein Info for MMJJ_RS07350 in Methanococcus maripaludis JJ

Annotation: 4Fe-4S binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF09383: NIL" amino acids 10 to 64 (55 residues), 45.4 bits, see alignment E=3.4e-15 PF12837: Fer4_6" amino acids 74 to 97 (24 residues), 29.4 bits, see alignment 2.9e-10 amino acids 108 to 127 (20 residues), 25.5 bits, see alignment 5.2e-09 PF13237: Fer4_10" amino acids 75 to 123 (49 residues), 34.7 bits, see alignment E=7.7e-12 PF00037: Fer4" amino acids 76 to 97 (22 residues), 34.3 bits, see alignment 8e-12 amino acids 107 to 128 (22 residues), 35.1 bits, see alignment 4.5e-12 PF12797: Fer4_2" amino acids 77 to 94 (18 residues), 25.1 bits, see alignment (E = 6.4e-09) amino acids 104 to 124 (21 residues), 24.9 bits, see alignment 7.6e-09 PF14697: Fer4_21" amino acids 78 to 128 (51 residues), 44.5 bits, see alignment E=7.7e-15 PF12800: Fer4_4" amino acids 80 to 95 (16 residues), 18.4 bits, see alignment (E = 1.2e-06) amino acids 110 to 124 (15 residues), 18.6 bits, see alignment (E = 1e-06) PF12838: Fer4_7" amino acids 81 to 126 (46 residues), 48.2 bits, see alignment E=6.5e-16 PF13187: Fer4_9" amino acids 81 to 127 (47 residues), 30.3 bits, see alignment E=1.9e-10

Best Hits

Swiss-Prot: 52% identical to FER2_METJA: Uncharacterized ferredoxin MJ0099 (MJ0099) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 97% identity to mmq:MmarC5_0220)

Predicted SEED Role

"Uncharacterized ferredoxin MJ0099"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (132 amino acids)

>MMJJ_RS07350 4Fe-4S binding protein (Methanococcus maripaludis JJ)
MKKRVFYWISGSNVREPVVSNVVLETGVMVNILKAKMEPREGFLILELTGDEGQIEKSIE
ILKKFGEVEDIPKIIQKDDEKCIDCGACVVHCPVGALSVDEEFKILLDEDECIGCKNCAK
ICPVNAIKIFEI