Protein Info for MMJJ_RS07275 in Methanococcus maripaludis JJ

Annotation: formate--phosphoribosylaminoimidazolecarboxamide ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF06849: DUF1246" amino acids 21 to 143 (123 residues), 157.5 bits, see alignment E=1.5e-50 PF06973: DUF1297" amino acids 174 to 360 (187 residues), 285.2 bits, see alignment E=2.1e-89

Best Hits

Swiss-Prot: 99% identical to PURP_METMP: 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase (purP) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K06863, 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase [EC: 6.3.4.-] (inferred from 99% identity to mmp:MMP1373)

MetaCyc: 77% identical to FAICAR synthetase monomer (Methanocaldococcus jannaschii)
RXN-10066 [EC: 6.3.4.23]

Predicted SEED Role

"Phosphoribosylaminoimidazolecarboxamide formyltransferase [alternate form]" in subsystem De Novo Purine Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>MMJJ_RS07275 formate--phosphoribosylaminoimidazolecarboxamide ligase (Methanococcus maripaludis JJ)
MIPKEEIMGIFEKYNKDEVTIVTVGSHTSLHILKGAKLEGFSTAVITTKDRAIPYKRFGV
ADKFIYVDQFSDISKEEIQQQLRDMNAIIVPHGSFIAYCGLDNVEDTFKVPMFGNRAILR
WEAERDLEGRLLGGSGLRIPKKYGGPDEIDGPVMVKFPGARGGRGYFPCSSVEEFWRKIG
EFKAKGVLTEDDVSKAHIEEYVVGANYCIHYFYSPLKDQVELMGIDRRYESSIDGLVRVP
AKDQLELNIDPSYVITGNFPVVIRESLLPQVFDMGDKLVAKAKEEVNPGMLGPFCLQSLC
NDNLELVVFEMSARVDGGTNTFMNGSPYSCLYTGEPLSMGQRIAKEIKLALELNMIDKVI
S