Protein Info for MMJJ_RS07260 in Methanococcus maripaludis JJ

Annotation: PspC domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 80 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 33 to 59 (27 residues), see Phobius details PF04024: PspC" amino acids 2 to 58 (57 residues), 84.4 bits, see alignment E=1.9e-28

Best Hits

KEGG orthology group: K03973, phage shock protein C (inferred from 98% identity to mmp:MMP1376)

Predicted SEED Role

"PspC domain protein, truncated"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (80 amino acids)

>MMJJ_RS07260 PspC domain-containing protein (Methanococcus maripaludis JJ)
MKRLYRSDKEKMLSGVCGGLAIYFNVDPTLIRLLWVLLFFMNPLMIIVYIIAAIIIPIAP
EGVSYDFSKEPEKIKAESEE