Protein Info for MMJJ_RS07235 in Methanococcus maripaludis JJ

Annotation: coenzyme F420 hydrogenase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 TIGR03295: coenzyme F420 hydrogenase, subunit alpha" amino acids 1 to 411 (411 residues), 603.4 bits, see alignment E=1.1e-185 PF00374: NiFeSe_Hases" amino acids 41 to 110 (70 residues), 59.4 bits, see alignment E=1.7e-20 amino acids 289 to 367 (79 residues), 26.1 bits, see alignment E=2.1e-10

Best Hits

Swiss-Prot: 71% identical to FRHA_METJA: Coenzyme F420 hydrogenase subunit alpha (frhA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00440, coenzyme F420 hydrogenase alpha subunit [EC: 1.12.98.1] (inferred from 100% identity to mmp:MMP1382)

Predicted SEED Role

"Coenzyme F420 hydrogenase alpha subunit (FruA) (EC 1.12.98.1) @ selenocysteine-containing" (EC 1.12.98.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.98.1

Use Curated BLAST to search for 1.12.98.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>MMJJ_RS07235 coenzyme F420 hydrogenase subunit alpha (Methanococcus maripaludis JJ)
MAEPVTISPTTRHEGHAKLVLNVDDEGIVTKAFYPNTTPVRGFETMLQGKTAAFGPIAVM
RICGICQATHGIASCEAIENAIDMEIPKDGMILRELLGLGNRMHSHPLHHLLIVDDFLKP
EEAGTLRVEGIKLIQRMRKAGQMVVDITGGEGIHPPNLMVGGMRTNITERAKSKLYYACR
EYEKDCNAMLEVLEMLMERYLDEIGIPDLGKHNLPYIATDSTFGNRDAINWKDVTEVPAQ
RYYADFPDIAQTATNQIPFYRGNPAEGGPRARMIKYGNFKPAGGAMDLNLARAMENFEAV
KRSLELIDELNINGTVREVPNFYNAKEEFGIGVHEAPRATNTHMAKMGKDGRIEKYNIIA
ASTWNFPAVEKAIEGYHHKYAEVIMRAYDIUASCATHVIVKDEQTKKVVEIREF