Protein Info for MMJJ_RS07210 in Methanococcus maripaludis JJ

Annotation: AmmeMemoRadiSam system protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04336: AmmeMemoRadiSam system protein B
  • amino acids 3 to 282 (280 residues), 312.5 bits, E=1.1e-97
• PF01875: Memo
  • amino acids 5 to 281 (277 residues), 279.8 bits, E=1e-87

Best Hits

Swiss-Prot: 99% identical to Y1387_METMP: MEMO1 family protein MMP1387 (MMP1387) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K06990, (no description) (inferred from 99% identity to mmp:MMP1387)

Predicted SEED Role

"Candidate gene for the hypothesized phosphomevalonate decarboxylase; COG1355, Predicted dioxygenase"

Protein Sequence (284 amino acids)

>MMJJ_RS07210 AmmeMemoRadiSam system protein B (Methanococcus maripaludis JJ)
MTRNPVVAGMFYPAEYHELLEMIEYCYLNPRGPKELPSKRGKYTKPLGIVSPHAGYIYSG
PVAAHGYKKISENISGEITAIILGPNHTGLGSGIATMKGTWKTPFGDMEIDNEFADRLWK
ECDILDMDENSHLREHSIEVQLPFLKHLEDLNIAKFKFVPISMMMQDYDSCIDVGYVIAK
VARELNRKIVIIASTDFSHYEPQEQASKKDAVVIKDILKLNDEEIFTDVVTHNISMCGYG
PVIAMVKAMKDLGARTSYLLYYSTSGDVTKDYSEVVGYASLLIK