Protein Info for MMJJ_RS07175 in Methanococcus maripaludis JJ

Annotation: DEAD/DEAH box helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 755 PF04851: ResIII" amino acids 15 to 168 (154 residues), 80.4 bits, see alignment E=6e-26 PF00270: DEAD" amino acids 18 to 174 (157 residues), 75.8 bits, see alignment E=1.4e-24 PF21210: RNA_helicase_helical" amino acids 222 to 326 (105 residues), 52.6 bits, see alignment E=2.1e-17 PF00271: Helicase_C" amino acids 339 to 448 (110 residues), 80 bits, see alignment E=6.4e-26 PF02732: ERCC4" amino acids 555 to 668 (114 residues), 103.5 bits, see alignment E=3.8e-33 PF14520: HHH_5" amino acids 700 to 747 (48 residues), 43 bits, see alignment 2.1e-14 PF12826: HHH_2" amino acids 701 to 749 (49 residues), 37.9 bits, see alignment 6.6e-13 PF00633: HHH" amino acids 719 to 747 (29 residues), 31 bits, see alignment (E = 6.3e-11)

Best Hits

KEGG orthology group: K10896, fanconi anemia group M protein [EC: 3.6.4.13] (inferred from 95% identity to mmp:MMP1395)

Predicted SEED Role

"Putative ATP-dependent RNA helicase MJ1505 (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.13

Use Curated BLAST to search for 3.6.1.- or 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (755 amino acids)

>MMJJ_RS07175 DEAD/DEAH box helicase (Methanococcus maripaludis JJ)
MHVTHPLIKPETIEARIYQQLVVASALKQNTLCVLGTGLGKTAIAALTIAGILSKQDGKV
LIIAPSRPLVDQHFKSMNQFLNIDSEKIVILNGKISPKKREAMWESGKIFIATPQVAEND
IISKILKPSQFSLLIADEAHHTTGNHSYTFVANKFKKKSHVLGLTASPGSNIDRIFEICG
NLGIEHVEIKTEEDPDVAPYVAKVKMRPKRVELPEEFEVNLTLLKNALKDRLRDLKENRV
IHSITVNKSELLGLNKKIMAMDDNIKYEMLRISSEAVKLEHAIEMLETQGKSTFLNYYQK
LLTQNTKSAKEITNDPRFIQAVKNLNEIDIEHPKYEKMLEIVKEILKENEKIIIFAQYRD
TVQKIVDLLSENGIEAIMFVGQSNKDGKGMNQKEQAKAIERFKNEANVLVSTSVSEEGID
ISSVNYVLFYEPVPSEIRMIQRRGRAARGEGGQVIVLIAQKTRDEGYYRAGLAKEKNMKN
ILKNMQTTLNKKLKELTEEESGNKENFDDTNNKDHYMDLRSVVSSKTSDNLEEKKPTKHD
KKSKSGLPNKATIIVDSRERHIGRYLSEKAEVEFKTLEIGDYILSDRVAVERKTAEDFEN
SIIDKRLFNQVMDLKKYERPLMIIEGNEFVRIHENAIRGMMFSIMIDYQIPVMFSRDIED
TADILVKLAEREQIKEKREISIRYGKRPMSLKERQKFLVEGLPDVGPVMAENLLDNFNSV
EDIFTASEAELKAVEGVGPITAKKIREVVSKKYRE