Protein Info for MMJJ_RS07050 in Methanococcus maripaludis JJ

Annotation: 50S ribosomal protein L30

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 TIGR01309: ribosomal protein uL30" amino acids 3 to 154 (152 residues), 218.2 bits, see alignment E=2.7e-69 PF00327: Ribosomal_L30" amino acids 3 to 53 (51 residues), 60.1 bits, see alignment E=7.4e-21

Best Hits

Swiss-Prot: 100% identical to RL30_METMP: 50S ribosomal protein L30 (rpl30) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02907, large subunit ribosomal protein L30 (inferred from 100% identity to mmp:MMP1420)

Predicted SEED Role

"LSU ribosomal protein L7e (L30p)" in subsystem Ribosome LSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>MMJJ_RS07050 50S ribosomal protein L30 (Methanococcus maripaludis JJ)
MAYAVVRVRGSVGVRGDIADTMKMLRLHRVNHCVIIPDTEHYTGMIKKVKDYVTYGEIDK
DTLVALILKRGRLPGNKRLSEELVKELTELPVEELAEKVIAGEIKIKDTPIKPVFRLHPP
RKGYDRAGVKKGFSIGGALGYRSGKINDLLNKMM