Protein Info for MMJJ_RS07010 in Methanococcus maripaludis JJ

Annotation: preprotein translocase subunit Sec61beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 53 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details PF03911: Sec61_beta" amino acids 11 to 50 (40 residues), 52.2 bits, see alignment E=2.6e-18

Best Hits

Swiss-Prot: 77% identical to SECG_META3: Preprotein translocase subunit SecG (secG) from Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)

KEGG orthology group: None (inferred from 91% identity to mvn:Mevan_0739)

Predicted SEED Role

"Preprotein translocase secG subunit (Protein transport protein SEC61 subunit beta homolog)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (53 amino acids)

>MMJJ_RS07010 preprotein translocase subunit Sec61beta (Methanococcus maripaludis JJ)
MAKNQDAGLSTSAGLVRYMDEDVSKIKIAPEKVLGLTVSIIIIEAVLNYGILI