Protein Info for MMJJ_RS07010 in Methanococcus maripaludis JJ
Annotation: preprotein translocase subunit Sec61beta
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 77% identical to SECG_META3: Preprotein translocase subunit SecG (secG) from Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
KEGG orthology group: None (inferred from 91% identity to mvn:Mevan_0739)Predicted SEED Role
"Preprotein translocase secG subunit (Protein transport protein SEC61 subunit beta homolog)"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (53 amino acids)
>MMJJ_RS07010 preprotein translocase subunit Sec61beta (Methanococcus maripaludis JJ) MAKNQDAGLSTSAGLVRYMDEDVSKIKIAPEKVLGLTVSIIIIEAVLNYGILI