Protein Info for MMJJ_RS06950 in Methanococcus maripaludis JJ

Annotation: 4-demethylwyosine synthase TYW1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR03972: wyosine biosynthesis protein TYW1" amino acids 7 to 298 (292 residues), 388.6 bits, see alignment E=8.1e-121 PF04055: Radical_SAM" amino acids 60 to 231 (172 residues), 54.9 bits, see alignment E=1.2e-18 PF08608: Wyosine_form" amino acids 239 to 300 (62 residues), 60.9 bits, see alignment E=1.2e-20

Best Hits

Swiss-Prot: 70% identical to TYW1_METJA: S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase (taw1) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 98% identity to mmp:MMP1440)

Predicted SEED Role

"Fe-S OXIDOREDUCTASE (1.8.-.-) Wyeosine biosynthesis" in subsystem Wyeosine-MimG Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>MMJJ_RS06950 4-demethylwyosine synthase TYW1 (Methanococcus maripaludis JJ)
MIPEQIHNILRKQRYQIKEHSGVKLCGWVRKSFLEGKECYKSKFYGINTHRCVQSTPSVA
WCQQSCIFCWRVLPKDLGLDSFESPKWKEPETVAEDILAMHKTVITGYKGILDRIGEEKY
LEATKPKHVALSLSGEPTMYPYLDELIEVFHKKGMSTFLVSNGILTDVIEKVNPTQLYIS
LDAYDLESYKKICGGTKEDWDSILNTLDILESKKRTCIRTTVIRNINDNILKFKELFERA
NSNFIELKSYMNVGYSRKRLNLDDMVKQVELLEMGKILGENSIFEIEDDSPESRVVLLTN
KNRKINPKIDFGF