Protein Info for MMJJ_RS06925 in Methanococcus maripaludis JJ

Annotation: GMP synthase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 2 to 183 (182 residues), 231.7 bits, E=2.2e-73
• PF00117: GATase
  • amino acids 3 to 182 (180 residues), 158.9 bits, E=1.2e-50
• PF07722: Peptidase_C26
  • amino acids 65 to 165 (101 residues), 43.7 bits, E=3e-15

Best Hits

Swiss-Prot: 97% identical to GUAAA_METMP: GMP synthase [glutamine-hydrolyzing] subunit A (guaAA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 97% identity to mmp:MMP1445)

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing], amidotransferase subunit (EC 6.3.5.2)" (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (17/21 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• guanosine ribonucleotides de novo biosynthesis (3/4 steps found)
• superpathway of purine nucleotide salvage (10/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (4/6 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (17/26 steps found)
• L-citrulline biosynthesis (4/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (4/8 steps found)
• L-glutamate and L-glutamine biosynthesis (3/7 steps found)
• superpathway of L-citrulline metabolism (6/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (189 amino acids)

>MMJJ_RS06925 GMP synthase subunit A (Methanococcus maripaludis JJ)
MIVILNNGGQYVHRIQRSLKYLDVPAKIVPNSTTLEEIAANPEIKGIILSGGPDITKATN
CENIALNSELPVLGICLGHQLISKAYGGAVSRADSEEYASIKIYVKEENDLFKGVPSEFT
AWASHMDEVKVTPDCFEVLAYSDICGVESIKHKEKSIYGVQFHPEVSHTEYGDIILKNFC
KKCGFEFKE