Protein Info for MMJJ_RS06850 in Methanococcus maripaludis JJ

Annotation: DUF1959 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF09218: DUF1959
  • amino acids 17 to 133 (117 residues), 170.8 bits, E=5.4e-55

Best Hits

Swiss-Prot: 59% identical to Y517_METJA: Uncharacterized protein MJ0517 (MJ0517) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K14104, energy-converting hydrogenase A subunit M (inferred from 94% identity to mmp:MMP1460)

Predicted SEED Role

"Energy conserving hydrogenase Eha protein M"

Protein Sequence (136 amino acids)

>MMJJ_RS06850 DUF1959 domain-containing protein (Methanococcus maripaludis JJ)
MLEEIDKNYKKSSLEQKYNIIKGNRYIMEEAIVPISKALKMSMDEVVDVFVKTCDGVALY
ESHAYVEQAKMGCLGRRVDIDLGLCWIADFFGLISKKDADLIRRKVVEDTIIKKIPYKEA
LENGRLLTIRILKGEE