Protein Info for MMJJ_RS06845 in Methanococcus maripaludis JJ

Annotation: NADH-quinone oxidoreductase subunit B family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF01058: Oxidored_q6" amino acids 21 to 130 (110 residues), 112.6 bits, see alignment E=5.6e-37

Best Hits

Swiss-Prot: 79% identical to Y516_METJA: Uncharacterized protein MJ0516 (MJ0516) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K14105, energy-converting hydrogenase A subunit N (inferred from 97% identity to mmz:MmarC7_0706)

Predicted SEED Role

"Energy conserving hydrogenase Eha small subunit homolog (protein N)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>MMJJ_RS06845 NADH-quinone oxidoreductase subunit B family protein (Methanococcus maripaludis JJ)
MIKDFVRKRSINVCLVNTGGCNGCDIEIVSCLAPRYDIEQYGIYVHNNPREADVLVVTGP
VTGAWEKRLLEIYEKTPEPKIVIAVGACALSGGIFKEGHIHGPVDKVIPVDAKLPGCPPR
PSEIISAVVSIAPDALAAKEKLLNQKLKEEKNKAKA