Protein Info for MMJJ_RS06790 in Methanococcus maripaludis JJ

Annotation: nucleotidyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF05636: HIGH_NTase1" amino acids 50 to 121 (72 residues), 49.3 bits, see alignment E=4.8e-17 PF16581: HIGH_NTase1_ass" amino acids 144 to 343 (200 residues), 284.8 bits, see alignment E=5e-89

Best Hits

Swiss-Prot: 96% identical to Y1471_METMP: Uncharacterized protein MMP1471 (MMP1471) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: None (inferred from 96% identity to mmp:MMP1471)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>MMJJ_RS06790 nucleotidyltransferase family protein (Methanococcus maripaludis JJ)
MEDEIKSFEKDRKLIIEDSKNSKNNIFEVQKLIEALKDEKNLKNIVVDFTEYNPLHNGHK
YCMDFGKSEGLFISVIPGPLERSGRGIPYLVNRHIRAEMALLAGADLVVEGPPMGIMGSG
QYMQCLIKIFSALNGDIIPRGYIEEETMERVINSINNGHHIKIKPYNISCIETCEKLGEK
LEIDNYVIASMSYTMYRLKENFPKWNPKFKFIERIEGISGTKIREGVFNNNFESIKHMLP
KTTIDVFKSFGDNLSEIILKRNEQMVLDTVNNFDLSRYLPENISEKLNEKEYYESIEEIK
ECIPRGFSKNNIERTISKLEARIEKETISKYIENYPANLRILNGINNHE