Protein Info for MMJJ_RS06760 in Methanococcus maripaludis JJ

Annotation: Ni-sirohydrochlorin a,c-diamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00379: cobyrinic acid a,c-diamide synthase
  • amino acids 3 to 445 (443 residues), 601.9 bits, E=3.9e-185
• PF01656: CbiA
  • amino acids 4 to 184 (181 residues), 71.6 bits, E=9.3e-24
• PF13500: AAA_26
  • amino acids 65 to 184 (120 residues), 33.6 bits, E=5.8e-12
• PF07685: GATase_3
  • amino acids 252 to 435 (184 residues), 126 bits, E=2.3e-40

Best Hits

Swiss-Prot: 93% identical to CBIA_METM5: Cobyrinate a,c-diamide synthase (cbiA) from Methanococcus maripaludis (strain C5 / ATCC BAA-1333)

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 94% identity to mmx:MmarC6_1196)

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (14/15 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (10/13 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (24/33 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9

Protein Sequence (447 amino acids)

>MMJJ_RS06760 Ni-sirohydrochlorin a,c-diamide synthase (Methanococcus maripaludis JJ)
MKRIVIAGTSSMVGKTTISTGIMKALSKKHNVQPYKIGPDYIDPTYHTEATNNKSRNLDS
FFMDEMQVRSIFKRHSKNKDINVIEGVRGLYEGISPYNDIGSTASVAKTINSPVILLMDA
RSLTRSASAIIKGFKSFDPNLNIKGVIFNKIRGEGHLNKLKEAVKYYDNEIEIIGAIPRD
DSLSVSQRHLGLVPTPENKQELLERIDLWGETVEKCLDLEKIVELSDENFDFCVDDKNKE
ETLWKVEKNNLKIAVALDESFNFYYWDNFDALEENGAKLKFFSPLNDSEVPDCDTIYLGG
GYPEIFSEKLSNNKSMVESIRNFDGKIYGECGGLMYLTNSIDGIEMLKLIDADAVMTPNV
QGLSYVKGTFEKDCIIGKKSKEFKAHEFHYSKLININENDFSYKINRGKGIINSMDGITS
KDGDIVGGYAHQHCIGNPYFAASLSKM