Protein Info for MMJJ_RS06760 in Methanococcus maripaludis JJ

Annotation: Ni-sirohydrochlorin a,c-diamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 TIGR00379: cobyrinic acid a,c-diamide synthase" amino acids 3 to 445 (443 residues), 601.9 bits, see alignment E=3.9e-185 PF01656: CbiA" amino acids 4 to 184 (181 residues), 71.6 bits, see alignment E=9.3e-24 PF13500: AAA_26" amino acids 65 to 184 (120 residues), 32.9 bits, see alignment E=9e-12 PF07685: GATase_3" amino acids 252 to 435 (184 residues), 126.8 bits, see alignment E=1.3e-40

Best Hits

Swiss-Prot: 93% identical to CBIA_METM5: Cobyrinate a,c-diamide synthase (cbiA) from Methanococcus maripaludis (strain C5 / ATCC BAA-1333)

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 94% identity to mmx:MmarC6_1196)

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>MMJJ_RS06760 Ni-sirohydrochlorin a,c-diamide synthase (Methanococcus maripaludis JJ)
MKRIVIAGTSSMVGKTTISTGIMKALSKKHNVQPYKIGPDYIDPTYHTEATNNKSRNLDS
FFMDEMQVRSIFKRHSKNKDINVIEGVRGLYEGISPYNDIGSTASVAKTINSPVILLMDA
RSLTRSASAIIKGFKSFDPNLNIKGVIFNKIRGEGHLNKLKEAVKYYDNEIEIIGAIPRD
DSLSVSQRHLGLVPTPENKQELLERIDLWGETVEKCLDLEKIVELSDENFDFCVDDKNKE
ETLWKVEKNNLKIAVALDESFNFYYWDNFDALEENGAKLKFFSPLNDSEVPDCDTIYLGG
GYPEIFSEKLSNNKSMVESIRNFDGKIYGECGGLMYLTNSIDGIEMLKLIDADAVMTPNV
QGLSYVKGTFEKDCIIGKKSKEFKAHEFHYSKLININENDFSYKINRGKGIINSMDGITS
KDGDIVGGYAHQHCIGNPYFAASLSKM