Protein Info for MMJJ_RS06745 in Methanococcus maripaludis JJ
Annotation: energy-coupling factor ABC transporter permease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 72% identical to CBIM_METV3: Putative cobalt transport protein CbiM (cbiM) from Methanococcus voltae (strain ATCC BAA-1334 / A3)
KEGG orthology group: K02007, cobalt/nickel transport system permease protein (inferred from 98% identity to mmq:MmarC5_0097)Predicted SEED Role
"Substrate-specific component CbiM of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (225 amino acids)
>MMJJ_RS06745 energy-coupling factor ABC transporter permease (Methanococcus maripaludis JJ) MHIMEGFLPPMWAAFWFVLSGIVVIYGIIQLNKLINDKPEVKPTLALAGAFMFILSSLKL PSVTGSCSHPTGGGLGAIMFGPAITAVLATIVLLFQAILLAHGGLTTLGANIFSMGIMGP ALGFLVFKLLKGKLNITWVVVLAAIFADWGTYATTSIQLALAYPLPDFGTALANFGTVFA VTQIPLAIMEGLLTGLIWDYIMKLRPDLLAKLGLIDPVKAEGGAE