Protein Info for MMJJ_RS06700 in Methanococcus maripaludis JJ

Annotation: L-seryl-tRNA(Sec) kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF07931: CPT" amino acids 1 to 155 (155 residues), 22.9 bits, see alignment E=2e-08 PF08433: KTI12" amino acids 1 to 250 (250 residues), 210.6 bits, see alignment E=9.9e-66 PF06414: Zeta_toxin" amino acids 2 to 133 (132 residues), 25.9 bits, see alignment E=1.8e-09 TIGR03574: L-seryl-tRNA(Sec) kinase" amino acids 2 to 250 (249 residues), 395.7 bits, see alignment E=4e-123 PF01583: APS_kinase" amino acids 2 to 114 (113 residues), 27.8 bits, see alignment E=7.2e-10 PF13671: AAA_33" amino acids 2 to 136 (135 residues), 63.7 bits, see alignment E=7.1e-21 PF13238: AAA_18" amino acids 3 to 120 (118 residues), 33 bits, see alignment E=2.4e-11

Best Hits

Swiss-Prot: 89% identical to PSTK_METMP: L-seryl-tRNA(Sec) kinase (pstK) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K10837, O-phosphoseryl-tRNA(Sec) kinase [EC: 2.7.1.164] (inferred from 89% identity to mmp:MMP1490)

Predicted SEED Role

"L-seryl-tRNA(Sec) kinase" in subsystem Selenocysteine metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.164

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>MMJJ_RS06700 L-seryl-tRNA(Sec) kinase (Methanococcus maripaludis JJ)
MLIILTGLPSVGKSTFSKAISKKMAEKNIDNIILGTDLIRESFPVWKESYEEFIRDSNNY
LIKKALESNFNVIVDDTNYYNSKRRDLMNIAKECNVNYVTIYLKAPLNLLLKRNIERGQK
IPNEVITNMYEKFDTPGTKYAWDLPDITVDTTEKIDHEKILSQILEINENKNLKIEEDNI
PKLKTIESNLVKIDSLTRNIVGNLIKSEKIDKKDIKLVSELRKSFLKTFKKIESENLDFE
KIEKDFLDYLKENLK