Protein Info for MMJJ_RS06615 in Methanococcus maripaludis JJ

Annotation: pyruvate synthase subunit PorD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 85 TIGR02179: 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family" amino acids 8 to 84 (77 residues), 113.3 bits, see alignment E=2.1e-37 PF13237: Fer4_10" amino acids 26 to 74 (49 residues), 29.6 bits, see alignment E=1.8e-10 PF00037: Fer4" amino acids 27 to 50 (24 residues), 25.3 bits, see alignment E=3.4e-09 amino acids 57 to 79 (23 residues), 30.3 bits, see alignment E=9.4e-11 PF14697: Fer4_21" amino acids 29 to 79 (51 residues), 39.3 bits, see alignment E=2.1e-13 PF12838: Fer4_7" amino acids 33 to 77 (45 residues), 29 bits, see alignment E=4.2e-10 PF12837: Fer4_6" amino acids 55 to 78 (24 residues), 27.3 bits, see alignment E=8.5e-10

Best Hits

Swiss-Prot: 72% identical to PORD_METJA: Pyruvate synthase subunit PorD (porD) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00171, pyruvate ferredoxin oxidoreductase, delta subunit [EC: 1.2.7.1] (inferred from 96% identity to mmx:MmarC6_1168)

MetaCyc: 64% identical to pyruvate synthase subunit delta (Methanothermobacter thermautotrophicus Delta H)
Pyruvate synthase. [EC: 1.2.7.1]

Predicted SEED Role

"Pyruvate:ferredoxin oxidoreductase, delta subunit (EC 1.2.7.1)" in subsystem Pyruvate:ferredoxin oxidoreductase (EC 1.2.7.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.1

Use Curated BLAST to search for 1.2.7.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (85 amino acids)

>MMJJ_RS06615 pyruvate synthase subunit PorD (Methanococcus maripaludis JJ)
MVNTGTIIYEPGSSAKNKTGSWRVFKPVLDQDKCVKCENCYIFCPEGCIQEKDGKFEIDY
DYCKGCLICEKECPVKAIKAEREEK