Protein Info for MMJJ_RS06615 in Methanococcus maripaludis JJ
Annotation: pyruvate synthase subunit PorD
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 72% identical to PORD_METJA: Pyruvate synthase subunit PorD (porD) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K00171, pyruvate ferredoxin oxidoreductase, delta subunit [EC: 1.2.7.1] (inferred from 96% identity to mmx:MmarC6_1168)MetaCyc: 64% identical to pyruvate synthase subunit delta (Methanothermobacter thermautotrophicus Delta H)
Pyruvate synthase. [EC: 1.2.7.1]
Predicted SEED Role
"Pyruvate:ferredoxin oxidoreductase, delta subunit (EC 1.2.7.1)" in subsystem Pyruvate:ferredoxin oxidoreductase (EC 1.2.7.1)
MetaCyc Pathways
- gluconeogenesis II (Methanobacterium thermoautotrophicum) (16/18 steps found)
- incomplete reductive TCA cycle (6/7 steps found)
- pyruvate fermentation to acetate III (2/2 steps found)
- pyruvate decarboxylation to acetyl CoA III (1/1 steps found)
- pyruvate fermentation to acetate VI (2/3 steps found)
- pyruvate fermentation to acetate and alanine (2/3 steps found)
- L-alanine degradation V (oxidative Stickland reaction) (1/2 steps found)
- reductive monocarboxylic acid cycle (1/2 steps found)
- pyruvate fermentation to acetate I (1/3 steps found)
- pyruvate fermentation to acetate VII (1/3 steps found)
- pyruvate fermentation to ethanol III (1/3 steps found)
- isopropanol biosynthesis (engineered) (2/5 steps found)
- pyruvate fermentation to acetone (2/5 steps found)
- pyruvate fermentation to acetate and lactate II (1/4 steps found)
- reductive TCA cycle I (6/11 steps found)
- Entner-Doudoroff pathway II (non-phosphorylative) (4/9 steps found)
- pyruvate fermentation to butanoate (2/7 steps found)
- glycerol degradation to butanol (8/16 steps found)
- reductive TCA cycle II (5/12 steps found)
- pyruvate fermentation to butanol I (2/8 steps found)
- reductive glycine pathway of autotrophic CO2 fixation (2/9 steps found)
- superpathway of Clostridium acetobutylicum acidogenic fermentation (2/9 steps found)
- lactate fermentation to acetate, CO2 and hydrogen (Desulfovibrionales) (1/8 steps found)
- pyruvate fermentation to hexanol (engineered) (3/11 steps found)
- superpathway of L-alanine fermentation (Stickland reaction) (1/9 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (1/9 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (34/56 steps found)
- L-glutamate degradation VII (to butanoate) (2/12 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (2/13 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (2/17 steps found)
- purine nucleobases degradation II (anaerobic) (5/24 steps found)
KEGG Metabolic Maps
- Butanoate metabolism
- Citrate cycle (TCA cycle)
- Glycolysis / Gluconeogenesis
- Propanoate metabolism
- Pyruvate metabolism
- Reductive carboxylate cycle (CO2 fixation)
- Trinitrotoluene degradation
Isozymes
Compare fitness of predicted isozymes for: 1.2.7.1
Use Curated BLAST to search for 1.2.7.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (85 amino acids)
>MMJJ_RS06615 pyruvate synthase subunit PorD (Methanococcus maripaludis JJ) MVNTGTIIYEPGSSAKNKTGSWRVFKPVLDQDKCVKCENCYIFCPEGCIQEKDGKFEIDY DYCKGCLICEKECPVKAIKAEREEK