Protein Info for MMJJ_RS06585 in Methanococcus maripaludis JJ

Annotation: alanine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00492: alanine racemase
  • amino acids 6 to 372 (367 residues), 428 bits, E=1.4e-132
• PF01168: Ala_racemase_N
  • amino acids 10 to 231 (222 residues), 273.1 bits, E=1.8e-85
• PF00842: Ala_racemase_C
  • amino acids 245 to 371 (127 residues), 164 bits, E=1.3e-52

Best Hits

Swiss-Prot: 98% identical to ALR_METMP: Alanine racemase (alr) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 98% identity to mmp:MMP1512)

Predicted SEED Role

"Alanine racemase (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

• alanine racemization (1/1 steps found)
• L-alanine degradation I (1/2 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
• ansatrienin biosynthesis (1/9 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (6/17 steps found)
• cyclosporin A biosynthesis (1/15 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• D-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.1

Protein Sequence (373 amino acids)

>MMJJ_RS06585 alanine racemase (Methanococcus maripaludis JJ)
MVSHPIWAEIDLSAIKNNIKEIRRITNPKSKVMAVVKANAYGHGAVEVSKVCLENGADRL
AVARSTEALELRNAGITCPILVFGYVTEEEILKMVENDITLTVYSLEIANSIQKIAEKLG
KNSKIHIKVDTGMSRLGFLPEKSSVETIKKIRELENIEVEGIYTHFADADNSDKTYTTMQ
FSKFTSFLHDLEENGIDIPIKHASNSAAIIDHPETHLNMVRPGIILYGLYPSELVHKERI
NLQPAMSLKVLVTHVKDVPENTKISYGCTFETKKQSKIASLPIGYADGFTRMLKNGNVLI
HGLRVPVVGRICMDQCMIDVTSIENVNVGDVVTVFGKDGNEKISIEEFGNKLGTINYELV
CMVSARVPRIYLH