Protein Info for MMJJ_RS06575 in Methanococcus maripaludis JJ

Annotation: prephenate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 PF07991: IlvN" amino acids 9 to 95 (87 residues), 20.8 bits, see alignment E=6.4e-08 PF03807: F420_oxidored" amino acids 9 to 98 (90 residues), 35 bits, see alignment E=4.4e-12 PF03446: NAD_binding_2" amino acids 17 to 164 (148 residues), 33.8 bits, see alignment E=8.7e-12 PF02153: PDH_N" amino acids 22 to 165 (144 residues), 128.5 bits, see alignment E=3.9e-41 PF20463: PDH_C" amino acids 167 to 270 (104 residues), 106.7 bits, see alignment E=1.8e-34

Best Hits

Swiss-Prot: 63% identical to Y612_METJA: Probable arogenate/prephenate dehydrogenase (MJ0612) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K04517, prephenate dehydrogenase [EC: 1.3.1.12] (inferred from 96% identity to mmp:MMP1514)

Predicted SEED Role

"Prephenate and/or arogenate dehydrogenase (unknown specificity) (EC 1.3.1.12)(EC 1.3.1.43)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 1.3.1.12, EC 1.3.1.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.12 or 1.3.1.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>MMJJ_RS06575 prephenate dehydrogenase (Methanococcus maripaludis JJ)
MRNGKIMIISIIGGTDGLGKWFASFLKNRGFDVLVSGRDVIKGKEVEKELRVTYTNNNID
AAEKGDIVIISVPINVTESVIKEVAPHVKKGSLLMDITSIKERPSKLMAEFSQNGVFVLP
THPMFGPETPSLNRQVVILTPTEKENPFFEKIKEFLEIEGAKVIVVSPKEHDKIMGVVQG
LTHFVYISLGSTLKDLGIDIKESRNFASPIYELMINIIARIIGQNPYLYADIQMHNPQIK
TIHDTFIKNCENISEIVQTKDRDSFVKNMKNSARHFGNETKRGLNCSNKAVYAISKETEK
LLKSVGKEIGLKHIYSENVHYGILKEVYSDNIVLKQNEKEVILNISNVSLMEDKELENWK
IKNLEKYFVDISVLFKKDIDLNIILELLAHKFEIKVIDTYYGDKIDENELSATFRINSYE
KEDLKKLEETFNKIIENIGGKLRY