Protein Info for MMJJ_RS06560 in Methanococcus maripaludis JJ

Annotation: site-2 protease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 80 to 106 (27 residues), see Phobius details amino acids 118 to 144 (27 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details

Best Hits

Swiss-Prot: 55% identical to Y611_METJA: Putative zinc metalloprotease MJ0611 (MJ0611) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 98% identity to mmp:MMP1517)

Predicted SEED Role

"Uncharacterized Zn-dependent protease MJ0611"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>MMJJ_RS06560 site-2 protease family protein (Methanococcus maripaludis JJ)
MSSFKGIFGFNRVELKDLLISSIAIAIVVVWPRGFPTFNIGFFLHFIAALLTVGIAFIFH
ELAHRTVARHFGAWSEFRAWYEGLAIAIFLKIIIGFTFIAPGAVYIHKDYLTTKENGLIS
VAGPLTNIVLAVLFMILPIPAIYYSGYYVDISSYGYFVNIFLAMFNLLPIYPFDGSKVMR
WNFLVWAVLFIPLIVLYFFV