Protein Info for MMJJ_RS06545 in Methanococcus maripaludis JJ

Annotation: hydrogenase nickel incorporation protein HypB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 TIGR00073: hydrogenase accessory protein HypB" amino acids 7 to 216 (210 residues), 282.8 bits, see alignment E=7.9e-89 PF02492: cobW" amino acids 39 to 195 (157 residues), 78.8 bits, see alignment E=4.2e-26

Best Hits

Swiss-Prot: 72% identical to HYPB_METJA: Probable hydrogenase maturation factor HypB (hypB) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K04652, hydrogenase nickel incorporation protein HypB (inferred from 100% identity to mmp:MMP1520)

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation-associated protein HypB" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>MMJJ_RS06545 hydrogenase nickel incorporation protein HypB (Methanococcus maripaludis JJ)
MHFVDVLNIGKDIIKANNKNADKNRKILEDHGIVAFDFMGAIGSGKTLLIEKLINELKDE
YKIACIAGDVIAKYDAGRMEKHGVKVIPLNTGKECHLDAHQIGHCFHDLDLDNLDIIFIE
NVGNLICPTDFDLGTHKRTVVVSVTEGDDTVEKHPEIFKTANLTIINKIDISEAVGADPQ
KMLNDAKKINKDMEVLLTAIKHDNGVSDVVEFIKKTIEEVKAQK