Protein Info for MMJJ_RS06535 in Methanococcus maripaludis JJ

Annotation: UPF0104 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 60 (24 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 224 to 273 (50 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 310 to 327 (18 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 13 to 320 (308 residues), 213.9 bits, see alignment E=1.9e-67 TIGR00374: TIGR00374 family protein" amino acids 17 to 334 (318 residues), 258.5 bits, see alignment E=5.2e-81

Best Hits

Swiss-Prot: 42% identical to Y1595_METJA: UPF0104 membrane protein MJ1595 (MJ1595) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07027, (no description) (inferred from 99% identity to mmp:MMP1522)

Predicted SEED Role

"UPF0104 membrane protein MTH_1261"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>MMJJ_RS06535 UPF0104 family protein (Methanococcus maripaludis JJ)
MDRKQHRLLRNIVVYGLGISIISFIIYKIGIFEVCAVLASANVGIYLFAVFIYLVTLYVL
SMRWNYLLKLNGYSAGSKNLLLLITMGQFINNVTPSMKGGSEPFRAYYLSKLEQIPYHVS
FSAVIIERILDSVIFLIFSFFVIIYFALKGVVYTEAFAIAWFLVMALTISIVYIAMHKKW
AFKITLQIAKIVTKFSSKTLNEQKIKDTINKFQKTMIFFKGNRRGMITALLISSAWWLLD
IFRIYVLFIAISTNVAFISVASTYLVALLVGILPTLPGGLGTSDTAMIAMYSFFNIPYSN
AAAGTLLDRSISYIGVTIIGSIAFKIIKKKSKENSYEVES