Protein Info for MMJJ_RS06510 in Methanococcus maripaludis JJ
Annotation: LL-diaminopimelate aminotransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to DAPAT_METMP: LL-diaminopimelate aminotransferase (dapL) from Methanococcus maripaludis (strain S2 / LL)
KEGG orthology group: K10206, LL-diaminopimelate aminotransferase [EC: 2.6.1.83] (inferred from 97% identity to mmx:MmarC6_1143)MetaCyc: 76% identical to L,L-diaminopimelate aminotransferase (Methanocaldococcus jannaschii)
LL-diaminopimelate aminotransferase. [EC: 2.6.1.83]
Predicted SEED Role
"Biosynthetic Aromatic amino acid aminotransferase beta (EC 2.6.1.57) @ LL-diaminopimelate aminotransferase (EC 2.6.1.83), methanococcal" (EC 2.6.1.57, EC 2.6.1.83)
MetaCyc Pathways
- superpathway of aromatic amino acid biosynthesis (17/18 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (14/15 steps found)
- L-lysine biosynthesis VI (7/7 steps found)
- superpathway of L-phenylalanine biosynthesis (9/10 steps found)
- superpathway of L-tyrosine biosynthesis (9/10 steps found)
- L-phenylalanine biosynthesis I (3/3 steps found)
- L-tyrosine biosynthesis I (3/3 steps found)
- L-phenylalanine biosynthesis III (cytosolic, plants) (2/2 steps found)
- 3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
- L-tyrosine degradation II (1/2 steps found)
- atromentin biosynthesis (1/2 steps found)
- L-phenylalanine degradation II (anaerobic) (1/3 steps found)
- L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
- L-phenylalanine degradation III (1/4 steps found)
- L-tyrosine degradation III (1/4 steps found)
- 4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
- L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
- L-tyrosine degradation I (1/5 steps found)
- L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
- superpathway of plastoquinol biosynthesis (1/5 steps found)
- L-phenylalanine degradation IV (mammalian, via side chain) (2/9 steps found)
- (S)-reticuline biosynthesis I (2/11 steps found)
- rosmarinic acid biosynthesis I (1/10 steps found)
- tropane alkaloids biosynthesis (1/11 steps found)
- superpathway of rosmarinic acid biosynthesis (1/14 steps found)
- superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (2/16 steps found)
- superpathway of chorismate metabolism (25/59 steps found)
- anaerobic aromatic compound degradation (Thauera aromatica) (2/27 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Lysine biosynthesis
- Methionine metabolism
- Novobiocin biosynthesis
- Phenylalanine metabolism
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.6.1.57
Use Curated BLAST to search for 2.6.1.57 or 2.6.1.83
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (416 amino acids)
>MMJJ_RS06510 LL-diaminopimelate aminotransferase (Methanococcus maripaludis JJ) MESYIQNLFAERIGGKSFGKEDVIYKFEKIKRAKQAAKLKYPDMELIDMGVGEPDEMADE SVVEVLCEEAKKHENRGYSDNGVQALKDEIPIYMEKIFGVKDLDPVNEVVHSIGSKPALA YITSVFINPGDVTLMTVPGYPVTATHTKWYGGSVETLPLLEKNNFLPELDAISKEVKEKA KILYLNYPNNPTGAQATKKFYKEAVDFAFENDLIVIQDAAYSALTYGDKPLSFLSLKDAK EVGVEIHSFSKAYNMTGWRLAFVAGNELIVRGFAAVKDNYDSGQFIPIQKAGIHCLRHPE ITEKTRAKYERRLSKMVKILKEAGFNAKMPGGTFYLYVKAPIGTKDGAKFANAEEFSQFM IKEKLISTVPWDDAGNFVRMAACFEAFKDGEISIEEEDRILNEVKRRLTEVEFVFE