Protein Info for MMJJ_RS06380 in Methanococcus maripaludis JJ

Annotation: signal recognition particle protein Srp54

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF02881: SRP54_N" amino acids 5 to 82 (78 residues), 58.5 bits, see alignment E=1.9e-19 PF13401: AAA_22" amino acids 99 to 217 (119 residues), 27.9 bits, see alignment E=7.6e-10 PF00448: SRP54" amino acids 101 to 295 (195 residues), 239.6 bits, see alignment E=7.1e-75 PF02492: cobW" amino acids 102 to 254 (153 residues), 23.2 bits, see alignment E=1.5e-08 PF02978: SRP_SPB" amino acids 325 to 423 (99 residues), 101.3 bits, see alignment E=9.4e-33

Best Hits

Swiss-Prot: 100% identical to SRP54_METMP: Signal recognition particle 54 kDa protein (srp54) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03106, signal recognition particle subunit SRP54 (inferred from 100% identity to mmp:MMP1551)

Predicted SEED Role

"Signal recognition particle, subunit Ffh SRP54 (TC 3.A.5.1.1)" in subsystem Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>MMJJ_RS06380 signal recognition particle protein Srp54 (Methanococcus maripaludis JJ)
MLDKLGQNLSDALNKLKNATFVDKKLVKEVIKDIQKALIQSDVNVKLVFNMSKEIERKAI
DEAPPKGLSKKEHIVKIVYDELVKLLGETTQKLELDPSKKSVILLIGIQGSGKTTSAAKL
ARYIQKKGLRPGLIAADVYRPAAYQQLKQLSEKINVPLFGDETRTKTPVEITKEGMEKLK
KVDVVIIDTAGRHKEEEGLLAEMKEMKDLTNPNEIILVIDGTLGQQAKNQAKAFKESVSE
IGSILVTKLDGSAKGGGALSAVAEINAPIKFIGTGEGVDNLEQFDPKKFISRILGLGDLD
SLLEKTEDIMDESTEESIDSILKGKFTLIELYAQLETISKMGPMKQILSMIPGMGGNMPK
EAAQLTEAKLKRYKIMMDSMTMEEKENPELIKTSRLQRIAKGAGVKQEEIKDLLKYYSTT
KNAFGNLKRGKMPKMGGQMGQIMRQLMYKD